U

Visitor

 • 

4 Messages

Wednesday, January 26th, 2022 3:37 PM

Closed

Permanent Error when replying to email

I am attempting to reply to a legitimate email received and get a Permanent error message. Why?

This is an automatically generated Delivery Status Notification.      
Delivery to the following recipients failed permanently:
   * Reason: Permanent Error

Official Employee

 • 

1K Messages

3 years ago

Good afternoon,

Can you please provide some of the specifics within the error? "permanent error" is the general error, but if its one coming from our servers it will include error codes to further elaborate and provide details to the error you are experiencing. These can sometimes be within the attachments of the error message you are receiving.

Visitor

 • 

4 Messages

3 years ago

This is all I got...

Return-Path: <>
Delivered-To: [Edited: "Personal Information"]
Received: from dovdir1-ch2g-05o.email.comcast.net ([96.102.19.11])
 by dovback1-ch2g-16o.email.comcast.net with LMTP
 id qDdaB59g8WHyOAAAk6lZaQ
 (envelope-from <>)
 for <[Edited: "Personal Information"]>; Wed, 26 Jan 2022 14:54:23 +0000
Received: from dovpxy-ch2g-11o.email.comcast.net ([96.102.19.11])
 by dovdir1-ch2g-05o.email.comcast.net with LMTP
 id CCHzBp9g8WGpIAAAIPL6lw
 (envelope-from <>)
 for <[Edited: "Personal Information"]>; Wed, 26 Jan 2022 14:54:23 +0000
Received: from reszmta-c1p-045197.sys.comcast.net ([96.102.19.11])
 by dovpxy-ch2g-11o.email.comcast.net with LMTP
 id EPdgBp9g8WH7MQAALnngFw
 (envelope-from <>)
 for <[Edited: "Personal Information"]>; Wed, 26 Jan 2022 14:54:23 +0000
Received: from resomta-c1p-023266.sys.comcast.net ([96.102.18.234])
 by reszmta-c1p-045197.sys.comcast.net with ESMTP
 id Cjg8n3aGcQHfRCjghnjNcM; Wed, 26 Jan 2022 14:54:19 +0000
Received: from resdmta-c1p-023853.sys.comcast.net ([96.102.19.46])
 by resomta-c1p-023266.sys.comcast.net with ESMTP
 id CjgPnFXGN8lHCCjgPnyC9a; Wed, 26 Jan 2022 14:54:01 +0000
X-CAA-SPAM: F00000
X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedvvddrfedugdeilecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddunecupfhothhifhhitggrthhiohhnucdluddttddttddmnecujfgurhepfffhvffugggtsehptddtredttdejnecuhfhrohhmpehmrghilhgvrhdquggrvghmohhnsegtohhmtggrshhtrdhnvghtnecuggftrfgrthhtvghrnhepffdtteejueehfedvgfevfeeuuddthfdufeffvdehteeluedvieelgeeuueelvdegnecukfhppeeliedruddtvddrudelrdegieenucevlhhushhtvghrufhiiigvpeegnecurfgrrhgrmhephhgvlhhopehrvghsughmthgrqdgtudhpqddtvdefkeehfedrshihshdrtghomhgtrghsthdrnhgvthdpihhnvghtpeeliedruddtvddrudelrdegiedpnhgspghrtghpthhtohepuddprhgtphhtthhopegrohhjieefsegtohhmtggrshhtrdhnvght
X-Xfinity-VMeta: sc=10000.00;st=bounce
Date: Wed, 26 Jan 2022 14:54:02 +0000
From: mailer-daemon@comcast.net
To: [Edited: "Personal Information"]
Subject: Permanent Error
MIME-Version: 1.0
Content-Type: multipart/report; boundary="------------I305M09060309060P_996316432088420"

This is a multi-part message in MIME format.

--------------I305M09060309060P_996316432088420
Content-Type: text/plain; charset=UTF-8;
Content-Transfer-Encoding: 8bit

      This is an automatically generated Delivery Status Notification.      

Delivery to the following recipients failed permanently:

   * [Edited: "Personal Information"]

Reason: Permanent Error


--------------I305M09060309060P_996316432088420
Content-Type: message/delivery-status; charset=UTF-8;
Content-Transfer-Encoding: 8bit

Reporting-MTA: dns; resdmta-c1p-023853.sys.comcast.net [96.102.19.19]
Received-From-MTA: dns; resomta-c1p-022590.sys.comcast.net [96.102.18.239]
Arrival-Date: Wed, 26 Jan 2022 14:54:00 +0000


Final-recipient: rfc822; [Edited: "Personal Information"]
Diagnostic-Code: smtp; 550 Administrative prohibition - envelope blocked - https://community.mimecast.com/docs/DOC-1369#550 [R6_Na5LpOQ2tvdnhlOR6OA.uk13]

Last-attempt-Date: Wed, 26 Jan 2022 14:54:02 +0000

--------------I305M09060309060P_996316432088420

(edited)

Official Employee

 • 

1K Messages

3 years ago

Good afternoon,

Do you by chance ever access your email using a VPN service?

Visitor

 • 

4 Messages

Official Employee

 • 

1K Messages

Good morning,

When you're replying to these emails - how are you doing it? via our website or an email client?

I am an Official Xfinity Employee.
Official Employees are from multiple teams within Xfinity: CARE, Product, Leadership.
We ask that you post publicly so people with similar questions may benefit from the conversation.
Was your question answered? Please, mark a reply as the Accepted Answer.tick

Gold Problem Solver

 • 

26.5K Messages

3 years ago

... Diagnostic-Code: smtp; 550 Administrative prohibition - envelope blocked - https://community.mimecast.com/docs/DOC-1369#550 [R6_Na5LpOQ2tvdnhlOR6OA.uk13] ...

https://community.mimecast.com/docs/DOC-1369 for code "550 Administrative prohibition envelope blocked" says:

Description: The sender's email address or domain has triggered a Blocked Senders Policy or there's a SPF hard rejection.
Recommended Resolution: Delete or modify the Blocked Senders policy to exclude the sender address.

(edited)

Visitor

 • 

4 Messages

@BruceW​ Sounds like a fine idea but how does one go about doing this?

Gold Problem Solver

 • 

26.5K Messages

3 years ago

... Sounds like a fine idea but how does one go about doing this?

I'd start with https://community.mimecast.com/s/contactsupport to see what Mimecast has to say. @XfinityCSAEmail may have more insight into how best to proceed.

Official Employee

 • 

1K Messages

3 years ago

Good afternoon, 

I've checked with mimecast already and it appears the recipient server has placed the block. Either whoever you are attempting to send to has requested the block or the server has placed the block on their behalf. The recipient will want to ask their email provider for further details on why they are blocking you from sending to them.

forum icon

New to the Community?

Start Here